LL-37
PreclinicalHuman cathelicidin antimicrobial peptide
Also known as: Cathelicidin, CAP-18 fragment, hCAP18
LL-37 is the only human cathelicidin antimicrobial peptide, a key part of innate immunity studied for its direct antimicrobial action, wound healing, and immune-signalling roles.
Molecular & research data
- Sequence
- [LL-37, 37 aa] (37 aa)
- CAS number
- 154947-66-7
- Molecular formula
- C205H340N60O53
- Molecular weight
- ≈4493 g/mol
- Half-life
- Short in circulation; activity is largely local
- Primary targets
- Microbial membranes, Innate immune signalling
- Routes (research)
- Subcutaneous, Topical
- Storage
- Lyophilised: −20 °C. Reconstituted: 2–8 °C, use within weeks.
Overview
LL-37 is the only cathelicidin antimicrobial peptide found in humans, produced by cleavage of the precursor protein hCAP18. It is a core component of innate immunity — a fast, non-specific first line of defence — and is found in immune cells, skin, and mucosal surfaces.
Mechanism of action
LL-37 is amphipathic, meaning it has both water-attracting and fat-attracting regions. This structure lets it:
- Disrupt microbial membranes directly, killing bacteria, fungi, and some viruses by permeabilising their cell walls
- Modulate innate immune signalling, recruiting and influencing immune cells
- Support wound healing and angiogenesis at sites of injury and infection
Because its action is largely local and membrane-based, LL-37 differs fundamentally from the receptor-mediated immunomodulation of Thymosin Alpha-1.
Common research uses
- Antimicrobial and anti-biofilm research
- Wound healing and skin-barrier studies
- Innate-immunity and inflammation research
- As a template for antimicrobial peptide drug design
LL-37 FAQ
What is LL-37?+
LL-37 is the active fragment of human cathelicidin (hCAP18), the only cathelicidin antimicrobial peptide found in humans. It is a frontline molecule of innate immunity.
How does LL-37 kill microbes?+
Its amphipathic structure lets it disrupt and permeabilise microbial cell membranes directly. It also modulates the immune response and supports wound healing.
Is LL-37 a drug?+
No. It is a naturally occurring human peptide studied in research; it is not an approved therapeutic, though it inspires antimicrobial drug development.
References
Related peptides
Last reviewed: 2026-06-26. Information is provided for research and educational reference only — see our disclaimer.